Structure of PDB 2ewj Chain A

Receptor sequence

>2ewjA (length=305) Species: 562 (Escherichia coli)

DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLN
RIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLN
AYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWT
REEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHA
CPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLH
LYVAD

3D structure

• PDB: 2ewj A molecular mousetrap determines polarity of termination of DNA replication in E. coli.
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S88 K89 T129 F140 H144 G149 L153 Y156 R169 A173 N174 K175 H176 I177 I178 K179 N180 K229 R241 W243 Q250 V285 H287 R288 P291 A293	S84 K85 T125 F136 H140 G145 L149 Y152 R165 A169 N170 K171 H172 I173 I174 K175 N176 K225 R237 W239 Q246 V281 H283 R284 P287 A289
BS02	dna	A	K89 A90 A91 R93 R157 T158 K175 S193 R198 V200 R232 V234 K235 P256 Y289 R302	K85 A86 A87 R89 R153 T154 K171 S189 R194 V196 R228 V230 K231 P252 Y285 R298

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006260 DNA replication
• GO:0006274 DNA replication termination
• GO:0071807 replication fork arrest involved in DNA replication termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ewj, PDBe:2ewj, PDBj:2ewj
• PDBsum: 2ewj
• PubMed: 16814717
• UniProt: P16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)