Structure of PDB 2ev9 Chain A

Receptor sequence

>2ev9A (length=261) Species: 300852 (Thermus thermophilus HB8)

MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEV
RRAFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQVEGRLFGFNTD
APGFLEALKAGGIPLKGPALVLGAGGAGRAVAFALREAGLEVWVWNRTPQ
RALALAEEFGLRAVPLEKAREARLLVNATRVGLEDPSASPLPAELFPEEG
AAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLAWQGALAFRLWTGLLPDP
SGMEEAARRAL

3D structure

• PDB: 2ev9 Crystal Structures of Shikimate Dehydrogenase AroE from Thermus thermophilus HB8 and its Cofactor and Substrate Complexes: Insights into the Enzymatic Mechanism
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K64 D100
• Catalytic site (residue number reindexed from 1): K64 D100
• Enzyme Commision number: 1.1.1.25: shikimate dehydrogenase (NADP(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SKM	A	S14 S16 N58 K64 N85 D100 Q235	S14 S16 N58 K64 N85 D100 Q235
BS02	NAP	A	L61 G123 A127 N146 R147 T148 R151 T179 R180 V181 L205 G228 L232	L61 G123 A127 N146 R147 T148 R151 T179 R180 V181 L205 G228 L232

Gene Ontology

Molecular Function

• GO:0004764 shikimate 3-dehydrogenase (NADP+) activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009423 chorismate biosynthetic process
• GO:0019632 shikimate metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2ev9, PDBe:2ev9, PDBj:2ev9
• PDBsum: 2ev9
• PubMed: 17825835
• UniProt: Q5SJF8|AROE_THET8 Shikimate dehydrogenase (NADP(+)) (Gene Name=aroE)