Structure of PDB 2ev6 Chain A |
>2ev6A (length=136) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLI YEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEH HLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH |
|
PDB | 2ev6 Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E11 H77 E102 |
E8 H74 E99 |
|
|
|
|