Structure of PDB 2ev0 Chain A

Receptor sequence
>2ev0A (length=131) Species: 1423 (Bacillus subtilis) [Search protein sequence]
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEY
LIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHL
SWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
3D structure
PDB2ev0 Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
ChainA
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CD A E11 H77 E99 E102 E10 H72 E94 E97
BS02 CD A D8 E99 E102 H103 D7 E94 E97 H98
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0030026 intracellular manganese ion homeostasis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ev0, PDBe:2ev0, PDBj:2ev0
PDBsum2ev0
PubMed16533030
UniProtP54512|MNTR_BACSU HTH-type transcriptional regulator MntR (Gene Name=mntR)

[Back to BioLiP]