Structure of PDB 2erg Chain A

Receptor sequence
>2ergA (length=65) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
FACVECRQQKSKCDACERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEA
IEKRFKELTRTLTNL
3D structure
PDB2erg Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein.
ChainA
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F35 A36 R41 K44 R79 F1 A2 R7 K10 R45 PDBbind-CN: Kd=25nM
BS02 dna A Q43 K44 R75 Y77 K78 R79 Q9 K10 R41 Y43 K44 R45 PDBbind-CN: Kd=25nM
BS03 ZN A C37 C57 C60 C67 C3 C23 C26 C33
BS04 ZN A C37 C40 C47 C57 C3 C6 C13 C23
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2erg, PDBe:2erg, PDBj:2erg
PDBsum2erg
PubMed16615914
UniProtP08638|LEUR_YEAST Regulatory protein LEU3 (Gene Name=LEU3)

[Back to BioLiP]