Structure of PDB 2ehz Chain A

Receptor sequence

>2ehzA (length=299) Species: 69011 (Pseudomonas sp. C18)

QAAVIELGYMGISVKDPDAWKSFATDMLGLQVLDEGEKDRFYLRMDYWHH
RIVVHHNGQDDLEYLGWRVAGKPEFEALGQKLIDAGYKIRICDKVEAQER
MVLGLMKTEDPGGNPTEIFWGPRIDMSNPFHPGRPLHGKFVTGDQGLGHC
IVRQTDVAEAHKFYSLLGFRGDVEYRIPLPNGMTAELSFMHCNARDHSIA
FGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKAL
TFYGATPSGWLIEPGWRGATAIDEAEYYVGDIFGHGVEATGYGLDVKLS

3D structure

• PDB: 2ehz Structural explanation for success and failure in the enzymatic ring-cleavage of 3,4 dihydroxybiphenyl and related PCB metabolites
• Chain: A
• Resolution: 1.35 Å

Enzymatic activity

• Enzyme Commision number: 1.13.11.56: 1,2-dihydroxynaphthalene dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE2	A	H152 H215 E266	H149 H212 E263
BS02	MCT	A	H152 Y178 F192 H200 H215 H247 N249 Y256	H149 Y175 F189 H197 H212 H244 N246 Y253
BS03	MCT	A	I154 V155 R156 F204 G205 M207 N214	I151 V152 R153 F201 G202 M204 N211
BS04	MCT	A	L244 F286	L241 F283
BS05	MCT	A	H58 E102 R103	H55 E99 R100
BS06	MCT	A	H194 N196 A197 A274 D276	H191 N193 A194 A271 D273
BS07	MCT	A	Q62 L65 E66 R212	Q59 L62 E63 R209

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008198 ferrous iron binding
• GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
• GO:0018554 1,2-dihydroxynaphthalene dioxygenase activity
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity

Biological Process

• GO:0009056 catabolic process
• GO:1901170 naphthalene catabolic process

External links

• PDB: RCSB:2ehz, PDBe:2ehz, PDBj:2ehz
• PDBsum: 2ehz
• UniProt: P0A108|NAHC_PSEU8 1,2-dihydroxynaphthalene dioxygenase (Gene Name=doxG)