Structure of PDB 2egn Chain A |
>2egnA (length=83) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
QQRKVLTLEKGDNQTFGFEIQTYGVTFVARVHESSPAQLAGLTPGDTIAS VNGLNVEGIRHREIVDIIKASGNVLRLETLYGT |
|
PDB | 2egn Crystal structures of autoinhibitory PDZ domain of Tamalin: implications for metabotropic glutamate receptor trafficking regulation |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Y187 T189 |
Y81 T83 |
|
|
|