Structure of PDB 2efq Chain A

Receptor sequence

>2efqA (length=150) Species: 273063 (Sulfurisphaera tokodaii str. 7)

MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGY
YAYINPASLNLDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGD
NDFIVMARYKTREEFMEKFLERVMSIPEVERTSAQVVVKIIKESPNIVIF

3D structure

• PDB: 2efq Crystal structure of glutamine receptor protein from Sulfolobus tokodaii strain 7 in complex with its effector L-glutamine: implications of effector binding in molecular association and DNA binding.
• Chain: A
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLN	A	P30 K31 S32	P30 K31 S32

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0043200 response to amino acid

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2efq, PDBe:2efq, PDBj:2efq
• PDBsum: 2efq
• PubMed: 18653535
• UniProt: F9VNT4