Structure of PDB 2eff Chain A

Receptor sequence

>2effA (length=106) Species: 562 (Escherichia coli)

MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKII
INRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAG
ETVSFR

3D structure

• PDB: 2eff Understanding the binding properties of an unusual metal-binding protein - a study of bacterial frataxin
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	D3 H58	D3 H58

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0046872 metal ion binding

Biological Process

• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2eff, PDBe:2eff, PDBj:2eff
• PDBsum: 2eff
• PubMed: 17651435
• UniProt: P27838|CYAY_ECOLI Iron-sulfur cluster assembly protein CyaY (Gene Name=cyaY)