Structure of PDB 2e76 Chain A

Receptor sequence

>2e76A (length=215) Species: 83541 (Mastigocladus laminosus)

MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFAT
GFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILH
VFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKI
VSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFML
LHFLMIRKQGISGPL

3D structure

• PDB: 2e76 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
• Chain: A
• Resolution: 3.41 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R207 I211

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	Q47 G51 F52 M54 Y58 R83 H86 R87 F131 G135 Y136 L138 P139 H187	Q47 G51 F52 M54 Y58 R83 H86 R87 F131 G135 Y136 L138 P139 H187
BS02	HEM	A	Y34 G37 T40 H100 V101 R103 V104 G109 R114 T117 W118 G121 V122 L124 H202 I206 I211 S212	Y34 G37 T40 H100 V101 R103 V104 G109 R114 T117 W118 G121 V122 L124 H202 I206 I211 S212
BS03	HEM	A	Y34 C35 G38 L41 F203 I206 R207 G210 I211	Y34 C35 G38 L41 F203 I206 R207 G210 I211
BS04	TDS	A	Y136 A147 I150 P155	Y136 A147 I150 P155

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2e76, PDBe:2e76, PDBj:2e76
• PDBsum: 2e76
• PubMed: 17498743
• UniProt: P83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)