Structure of PDB 2e5y Chain A

Receptor sequence

>2e5yA (length=133) Species: 2334 (Bacillus sp. PS3)

MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAA
RLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERA
ERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK

3D structure

• PDB: 2e5y Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
• Chain: A
• Resolution: 1.92 Å

Enzymatic activity

• Enzyme Commision number: 3.6.3.14: Transferred entry: 7.1.2.2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	E83 I88 D89 R92 A93 R122 R126	E83 I88 D89 R92 A93 R122 R126	MOAD: Kd=22mM PDBbind-CN: -logKd/Ki=5.85,Kd=1.4uM

Gene Ontology

Molecular Function

• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0015986 proton motive force-driven ATP synthesis

Cellular Component

• GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

External links

• PDB: RCSB:2e5y, PDBe:2e5y, PDBj:2e5y
• PDBsum: 2e5y
• PubMed: 17581881
• UniProt: P07678|ATPE_BACP3 ATP synthase epsilon chain (Gene Name=atpC)