Structure of PDB 2e2z Chain A |
>2e2zA (length=100) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
GSHMVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLI ADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAK |
|
PDB | 2e2z Structural basis of functional cooperation of Tim15/Zim17 with yeast mitochondrial Hsp70 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C16 C41 |
C16 C41 |
|
|
|
|