Structure of PDB 2dwm Chain A |
>2dwmA (length=105) Species: 562 (Escherichia coli) [Search protein sequence] |
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVS DASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHAL PILLR |
|
PDB | 2dwm Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA. |
Chain | A |
Resolution | 3.15 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
F16 D17 F36 K61 |
F16 D17 F36 K61 |
|
|
|
|