Structure of PDB 2dvs Chain A |
>2dvsA (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI FLQKVASMPQEEQE |
|
PDB | 2dvs Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain. |
Chain | A |
Resolution | 2.04 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
N90 D94 I96 |
N84 D88 I90 |
|
|
|