Structure of PDB 2dr8 Chain A

Receptor sequence

>2dr8A (length=437) Species: 2234 (Archaeoglobus fulgidus)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD

3D structure

• PDB: 2dr8 Complete crystallographic analysis of the dynamics of CCA sequence addition
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	V127 T130 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 G346 P347 N354 K357 F358 R361 Y392 H396 H398 G401 K402	V127 T130 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 G346 P347 N354 K357 F358 R361 Y392 H396 H398 G401 K402
BS02	MG	A	E59 D61	E59 D61
BS03	CTP	A	S47 D61 T130 H133 K152 Y161 Y173 R224	S47 D61 T130 H133 K152 Y161 Y173 R224

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:2dr8, PDBe:2dr8, PDBj:2dr8
• PDBsum: 2dr8
• PubMed: 17051158
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)