Structure of PDB 2doq Chain A

Receptor sequence

>2doqA (length=146) Species: 4932 (Saccharomyces cerevisiae)

SELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDL
IDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKIS
IKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTD

3D structure

• PDB: 2doq Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
• Chain: A
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D33 N35 D37 F39 E44	D19 N21 D23 F25 E30
BS02	CA	A	D106 D108 T110 K112 N117	D92 D94 T96 K98 N103
BS03	CA	A	D142 D144 D146 E148 N150 E153	D128 D130 D132 E134 N136 E139

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0008017 microtubule binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0006406 mRNA export from nucleus
• GO:0030474 spindle pole body duplication
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0048193 Golgi vesicle transport
• GO:0051301 cell division

Cellular Component

• GO:0005634 nucleus
• GO:0005635 nuclear envelope
• GO:0005737 cytoplasm
• GO:0005816 spindle pole body
• GO:0005825 half bridge of spindle pole body
• GO:0005856 cytoskeleton
• GO:0044732 mitotic spindle pole body
• GO:0070390 transcription export complex 2

External links

• PDB: RCSB:2doq, PDBe:2doq, PDBj:2doq
• PDBsum: 2doq
• PubMed: 16785321
• UniProt: P06704|CDC31_YEAST Cell division control protein 31 (Gene Name=CDC31)