Structure of PDB 2dmj Chain A |
>2dmjA (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSSGSSGMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPM FDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGG SGPSSG |
|
PDB | 2dmj Solution structure of the first zf-PARP domain of human Poly(ADP-ribose)polymerase-1 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C28 C31 H60 C63 |
C28 C31 H60 C63 |
|
|
|
|