Structure of PDB 2dfn Chain A

Receptor sequence
>2dfnA (length=165) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFAT
DGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLE
ISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTN
RRNPGAVVRHILSRL
3D structure
PDB2dfn Effects of the magnesium and chloride ions and shikimate on the structure of shikimate kinase from Mycobacterium tuberculosis
ChainA
Resolution1.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.71: shikimate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CL A P11 K15 G80 P10 K14 G79
BS02 ADP A G12 S13 G14 K15 S16 T17 R110 R117 R153 P155 G11 S12 G13 K14 S15 T16 R109 R116 R152 P154
BS03 SKM A D34 I45 F57 R58 G79 G80 G81 R136 D33 I44 F56 R57 G78 G79 G80 R135
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004765 shikimate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0008652 amino acid biosynthetic process
GO:0009073 aromatic amino acid family biosynthetic process
GO:0009423 chorismate biosynthetic process
GO:0016310 phosphorylation
GO:0019632 shikimate metabolic process
GO:0019752 carboxylic acid metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2dfn, PDBe:2dfn, PDBj:2dfn
PDBsum2dfn
PubMed17183161
UniProtP9WPY3|AROK_MYCTU Shikimate kinase (Gene Name=aroK)

[Back to BioLiP]