Structure of PDB 2def Chain A |
>2defA (length=146) Species: 562 (Escherichia coli) [Search protein sequence] |
VLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQV DIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVP RAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS |
|
PDB | 2def Solution structure of nickel-peptide deformylase. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
A |
C90 I93 H132 H136 |
C89 I92 H131 H135 |
|
|
|
|