Structure of PDB 2d8r Chain A |
>2d8rA (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSSGSSGMPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKN FVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHISGPSSG |
|
PDB | 2d8r Solution structure of the thap domain of the human thap domain-containing protein 2 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C12 C17 C60 H63 |
C12 C17 C60 H63 |
|
|
|