Structure of PDB 2d7h Chain A |
>2d7hA (length=102) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
AHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDAS ELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPIL LR |
|
PDB | 2d7h Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA. |
Chain | A |
Resolution | 3.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
D17 Y18 K61 |
D14 Y15 K58 |
|
|
|
|