Structure of PDB 2d2c Chain A

Receptor sequence

>2d2cA (length=202) Species: 83541 (Mastigocladus laminosus)

EIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKPTV
TEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKK
PRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVG
VLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGIS
GP

3D structure

• PDB: 2d2c Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
• Chain: A
• Resolution: 3.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R195 I199

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F44 Q47 G51 F52 M54 R83 H86 A90 M93 F131 G135 Y136 L138 P139 H187	F32 Q35 G39 F40 M42 R71 H74 A78 M81 F119 G123 Y124 L126 P127 H175
BS02	HEM	A	G37 G38 T40 M97 H100 V104 G109 W118 G121 V122 L124 H202 I206	G25 G26 T28 M85 H88 V92 G97 W106 G109 V110 L112 H190 I194
BS03	HEC	A	Y34 C35	Y22 C23

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2d2c, PDBe:2d2c, PDBj:2d2c
• PDBsum: 2d2c
• PubMed: 16371475
• UniProt: P83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)