Structure of PDB 2czi Chain A

Receptor sequence
>2cziA (length=259) Species: 9606 (Homo sapiens) [Search protein sequence]
PWEECFQAAVQLALRAGQIIRKALTEETKTSAADLVTETDHLVEDLIISE
LRERFPSHRFIAEEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFA
VRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTE
IGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYY
QFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLI
AQALQTINY
3D structure
PDB2czi Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
ChainA
Resolution3.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E81 D101 I103 D104 T106 D231
Catalytic site (residue number reindexed from 1) E63 D78 I80 D81 T83 D208
Enzyme Commision number 3.1.3.25: inositol-phosphate phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A E81 D101 I103 D104 E63 D78 I80 D81
BS02 CA A D101 D104 D231 D78 D81 D208
BS03 PO4 A E81 I103 D104 G105 T106 E63 I80 D81 G82 T83
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008934 inositol monophosphate 1-phosphatase activity
GO:0016787 hydrolase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0052832 inositol monophosphate 3-phosphatase activity
GO:0052833 inositol monophosphate 4-phosphatase activity
GO:0052834 inositol monophosphate phosphatase activity
Biological Process
GO:0006020 inositol metabolic process
GO:0006021 inositol biosynthetic process
GO:0006796 phosphate-containing compound metabolic process
GO:0007165 signal transduction
GO:0010226 response to lithium ion
GO:0046854 phosphatidylinositol phosphate biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2czi, PDBe:2czi, PDBj:2czi
PDBsum2czi
PubMed17340635
UniProtO14732|IMPA2_HUMAN Inositol monophosphatase 2 (Gene Name=IMPA2)

[Back to BioLiP]