Structure of PDB 2cym Chain A

Receptor sequence

>2cymA (length=107) Species: 881 (Nitratidesulfovibrio vulgaris) [Search protein sequence]

APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAG
CHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGC
KKSKCHE

3D structure

PDB

2cym Effects of amino acid substitution on three-dimensional structure: an X-ray analysis of cytochrome c3 from Desulfovibrio vulgaris Hildenborough at 2 A resolution.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	A	M11 E12 A13 T14 Q16 V18 Y65 Y66 H70 C79 V80 H83 T98 C100 C105 H106	M11 E12 A13 T14 Q16 V18 Y65 Y66 H70 C79 V80 H83 T98 C100 C105 H106
BS02	HEM	A	C33 H35 V37 D42 R44 C46 C51 H52 H67 V68 T74 K75 F76	C33 H35 V37 D42 R44 C46 C51 H52 H67 V68 T74 K75 F76
BS03	HEM	A	A4 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46	A4 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46
BS04	HEM	A	F20 N21 T24 H25 V28 C79 C82 H83 K93 K104	F20 N21 T24 H25 V28 C79 C82 H83 K93 K104

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0009061	anaerobic respiration

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2cym, PDBe:2cym, PDBj:2cym
PDBsum	2cym
PubMed	1663945
UniProt	P00131\|CYC3_NITV2 Cytochrome c3 (Gene Name=DVU_3171)

[Back to BioLiP]