Structure of PDB 2cy4 Chain A |
>2cy4A (length=129) Species: 10090 (Mus musculus) [Search protein sequence] |
ADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRV SPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERA QPDVHFFQGLLLGAELIREDIQGALQNYR |
|
PDB | 2cy4 Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal) |
Chain | A |
Resolution | 1.94 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D32 D150 |
D2 D120 |
|
|
|