Structure of PDB 2cy3 Chain A

Receptor sequence

>2cy3A (length=118) Species: 52561 (Desulfomicrobium norvegicum)

ADAPGDDYVISAPEGMKAKPKGDKPGALQKTVPFPHTKHATVECVQCHHT
LEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALK
KDKKPTGPTACGKCHTTN

3D structure

• PDB: 2cy3 Crystal structure of cytochrome c3 from Desulfovibrio desulfuricans Norway at 1.7 A resolution.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	P4 Y8 F34 H36 H39 V42 C44 C47 H48 V58 K60 C61	P4 Y8 F34 H36 H39 V42 C44 C47 H48 V58 K60 C61
BS02	HEC	A	H49 T50 C61 C66 H67 I81 T90 Q91	H49 T50 C61 C66 H67 I81 T90 Q91
BS03	HEC	A	F34 K38 H39 Q91 C92 C95 H96 T106 G107 P108	F34 K38 H39 Q91 C92 C95 H96 T106 G107 P108
BS04	HEC	A	S11 A12 L28 Q29 V32 E85 F88 H89 I93 H96 T109 C111 C114 H115	S11 A12 L28 Q29 V32 E85 F88 H89 I93 H96 T109 C111 C114 H115

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2cy3, PDBe:2cy3, PDBj:2cy3
• PDBsum: 2cy3
• PubMed: 7966289
• UniProt: P00136|CYC31_DESNO Cytochrome c3, 13 kDa