Structure of PDB 2ct9 Chain A

Receptor sequence

>2ct9A (length=185) Species: 10116 (Rattus norvegicus) [Search protein sequence]

LLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPEL
AINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEEPLNSRSNKLHFA
FRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGD
SAISFTEFVKVLEKVDVEQKMSIRFLHKLAAALEH

3D structure

PDB

2ct9 Structural characterization of calcineurin B homologous protein 1

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D123 D125 D127 K129 E134	D105 D107 D109 K111 E116
BS02	CA	A	D164 D166 D168 A170 E175	D146 D148 D150 A152 E157

Gene Ontology

	Molecular Function
GO:0004860	protein kinase inhibitor activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0015385	sodium:proton antiporter activity
GO:0019900	kinase binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding

	Biological Process
GO:0001578	microtubule bundle formation
GO:0001933	negative regulation of protein phosphorylation
GO:0006469	negative regulation of protein kinase activity
GO:0006611	protein export from nucleus
GO:0006903	vesicle targeting
GO:0006906	vesicle fusion
GO:0010923	negative regulation of phosphatase activity
GO:0015031	protein transport
GO:0022406	membrane docking
GO:0031122	cytoplasmic microtubule organization
GO:0031397	negative regulation of protein ubiquitination
GO:0031953	negative regulation of protein autophosphorylation
GO:0032088	negative regulation of NF-kappaB transcription factor activity
GO:0032417	positive regulation of sodium:proton antiporter activity
GO:0035725	sodium ion transmembrane transport
GO:0042308	negative regulation of protein import into nucleus
GO:0050821	protein stabilization
GO:0051222	positive regulation of protein transport
GO:0051259	protein complex oligomerization
GO:0051453	regulation of intracellular pH
GO:0060050	positive regulation of protein glycosylation
GO:0061024	membrane organization
GO:0061025	membrane fusion
GO:0070885	negative regulation of calcineurin-NFAT signaling cascade
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0071468	cellular response to acidic pH
GO:0090314	positive regulation of protein targeting to membrane

	Cellular Component
GO:0000139	Golgi membrane
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0012505	endomembrane system
GO:0015630	microtubule cytoskeleton
GO:0030133	transport vesicle
GO:0045121	membrane raft
GO:1990351	transporter complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ct9, PDBe:2ct9, PDBj:2ct9
PDBsum	2ct9
PubMed	15987692
UniProt	P61023\|CHP1_RAT Calcineurin B homologous protein 1 (Gene Name=Chp1)

[Back to BioLiP]