Structure of PDB 2ct5 Chain A |
>2ct5A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSSGSSGSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSY HLEKNHPEEFCEFVKSNSGPSSG |
|
PDB | 2ct5 Solution Structure of the zinc finger BED domain of the zinc finger BED domain containing protein 1 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C32 C35 H51 H56 |
C32 C35 H51 H56 |
|
|
|
|