Structure of PDB 2cny Chain A

Receptor sequence

>2cnyA (length=123)

DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTG
TAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVL
TGPAQNVTADTYPITLDVVGYQP

3D structure

• PDB: 2cny Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	L23 V25 L27 L33 K34 A35 K79 E101 K102 W103 W108 V128 A130 D131 T132 Y133 P134 I135 T136 L137 D138 V139 V140 G141 Y142 Q143 P144	L2 V4 L6 L12 K13 A14 K58 E80 K81 W82 W87 V107 A109 D110 T111 Y112 P113 I114 T115 L116 D117 V118 V119 G120 Y121 Q122 P123

External links

• PDB: RCSB:2cny, PDBe:2cny, PDBj:2cny
• PDBsum: 2cny
• PubMed: 16793551
• UniProt: Q8ZRK4