Structure of PDB 2cnq Chain A

Receptor sequence

>2cnqA (length=301) Species: 4932 (Saccharomyces cerevisiae)

SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIP
EKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQ
LEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKES
QEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKD
YAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGES
QDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW
S

3D structure

• PDB: 2cnq Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
• Chain: A
• Resolution: 1.0 Å

Enzymatic activity

• Enzyme Commision number: 6.3.2.6: phosphoribosylaminoimidazolesuccinocarboxamide synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	G18 K19 V20 R21 I23 L31 F33 H75 L114 E219 D233	G17 K18 V19 R20 I22 L30 F32 H74 L113 E215 D229
BS02	AMZ	A	E118 R122 G127 S128 D215 K217 D239 S240 S241 R242 R264	E117 R121 G126 S127 D211 K213 D235 S236 S237 R238 R260
BS03	AMZ	A	E62 K66 V77 I79 L107 L108	E61 K65 V76 I78 L106 L107
BS04	AMP	A	E62 K66 V77 I79 I85 L107 L108	E61 K65 V76 I78 I84 L106 L107
BS05	ADP	A	K19 S40 A41 Y42 D43 H170 D171 K260 R264	K18 S39 A40 Y41 D42 H166 D167 K256 R260

Gene Ontology

Molecular Function

• GO:0004639 phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006189 'de novo' IMP biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2cnq, PDBe:2cnq, PDBj:2cnq
• PDBsum: 2cnq
• UniProt: P27616|PUR7_YEAST Phosphoribosylaminoimidazole-succinocarboxamide synthase (Gene Name=ADE1)