Structure of PDB 2cie Chain A |
>2cieA (length=64) Species: 2242 (Halobacterium salinarum) [Search protein sequence] |
VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEE RTYQTEVQVAFELD |
|
PDB | 2cie Dodecin Sequesters Fad in Closed Conformation from the Aqueous Solution. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FAD |
A |
V35 W36 |
V34 W35 |
|
|
|