Structure of PDB 2ch9 Chain A

Receptor sequence

>2ch9A (length=126) Species: 9606 (Homo sapiens)

TCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESR
ITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSC
YSEVWVVPWLQHFEVPVLRCHHHHHH

3D structure

• PDB: 2ch9 Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FUL	A	N62 C63 T64 N65	N38 C39 T40 N41
BS02	ZN	A	H145 H147	H121 H123
BS03	ZN	A	H146 H149	H122 H125

Gene Ontology

Molecular Function

• GO:0004866 endopeptidase inhibitor activity
• GO:0004869 cysteine-type endopeptidase inhibitor activity
• GO:0005515 protein binding
• GO:0030414 peptidase inhibitor activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006955 immune response
• GO:0010466 negative regulation of peptidase activity
• GO:0031643 positive regulation of myelination
• GO:1903979 negative regulation of microglial cell activation

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0005764 lysosome
• GO:0005768 endosome
• GO:0005770 late endosome
• GO:0005771 multivesicular body
• GO:0005783 endoplasmic reticulum
• GO:0005794 Golgi apparatus
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:2ch9, PDBe:2ch9, PDBj:2ch9
• PDBsum: 2ch9
• PubMed: 16601115
• UniProt: O76096|CYTF_HUMAN Cystatin-F (Gene Name=CST7)