Structure of PDB 2cdn Chain A

Receptor sequence
>2cdnA (length=186) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
PRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
GVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKA
LHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYR
DETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
3D structure
PDB2cdn The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R88 R127 R129 R140
Catalytic site (residue number reindexed from 1) K18 R93 R132 R134 R145
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A T31 G32 R36 L53 D57 L58 V59 T64 G85 R88 Q92 R127 R129 R140 T36 G37 R41 L58 D62 L63 V64 T69 G90 R93 Q97 R132 R134 R145
BS02 ADP A G10 G12 K13 G14 T15 R123 R127 G166 M168 G15 G17 K18 G19 T20 R128 R132 G171 M173
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006144 purine nucleobase metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009141 nucleoside triphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2cdn, PDBe:2cdn, PDBj:2cdn
PDBsum2cdn
PubMed16672241
UniProtP9WKF5|KAD_MYCTU Adenylate kinase (Gene Name=adk)

[Back to BioLiP]