Structure of PDB 2cc8 Chain A |
>2cc8A (length=64) Species: 478009 (Halobacterium salinarum R1) [Search protein sequence] |
VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEE RTYQTEVQVAFELD |
|
PDB | 2cc8 Dodecins: A Family of Lumichrome Binding Proteins. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
RBF |
A |
V35 W36 |
V34 W35 |
MOAD: Kd=35.76nM |
|
|
|