Structure of PDB 2cbp Chain A |
>2cbpA (length=96) Species: 3659 (Cucumis sativus) [Search protein sequence] |
AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFS TCNTPAGAKVYTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNAL |
|
PDB | 2cbp The structure of a phytocyanin, the basic blue protein from cucumber, refined at 1.8 A resolution. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H39 C79 H84 M89 |
H39 C79 H84 M89 |
|
|
|
|