Structure of PDB 2c8s Chain A

Receptor sequence
>2c8sA (length=149) Species: 408 (Methylorubrum extorquens) [Search protein sequence]
SQGKEGGRDTPAVKKFLETGENLYIDDKSCLRNGESLFATSCSGCHGHLA
EGKLGPGLNDNYWTYPSNTTDVGLFATIFGGANGMMGPHNENLTPDEMLQ
TIAWIRHLYTGPKQDAVWLNDEQKKAYTPYKQGEVIPKDAKGQCKPLDE
3D structure
PDB2c8s The 1.6A X-Ray Structure of the Unusual C-Type Cytochrome, Cytochrome Cl, from the Methylotrophic Bacterium Methylobacterium Extorquens.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A S64 C65 C68 H69 P79 L81 W86 T87 Y88 N91 L97 I101 P111 H112 S41 C42 C45 H46 P56 L58 W63 T64 Y65 N68 L74 I78 P88 H89
BS02 CA A G80 D83 Y85 G57 D60 Y62
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015945 methanol metabolic process
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c8s, PDBe:2c8s, PDBj:2c8s
PDBsum2c8s
PubMed16414073
UniProtP14774|CYCL_METEA Cytochrome c-L (Gene Name=moxG)

[Back to BioLiP]