Structure of PDB 2c78 Chain A

Receptor sequence

>2c78A (length=397) Species: 300852 (Thermus thermophilus HB8)

KPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPEERA
RGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSA
ADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLL
NQYEFPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDE
YIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGL
APETRKTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPG
SITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPG
VEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE

3D structure

• PDB: 2c78 Structural basis of the action of pulvomycin and GE2270 A on elongation factor Tu.
• Chain: A
• Resolution: 1.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T62 H85
• Catalytic site (residue number reindexed from 1): D13 K16 T17 T54 H77
• Enzyme Commision number: 3.1.5.1: dGTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	V20 D21 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176	V12 D13 G15 K16 T17 T18 Y39 I53 T54 G76 N128 K129 D131 M132 S166 L168
BS02	MG	A	T25 T62	T17 T54
BS03	PUL	A	I89 I93 T94 A97 Q98 V126 E226 F229 G240 R241 E271 H273 V286 Y343 F344 R345 T346 R385 A387 R389	I81 I85 T86 A89 Q90 V118 E218 F221 G232 R233 E263 H265 V278 Y335 F336 R337 T338 R377 A379 R381

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2c78, PDBe:2c78, PDBj:2c78
• PDBsum: 2c78
• PubMed: 16734421
• UniProt: Q5SHN6|EFTU1_THET8 Elongation factor Tu-A (Gene Name=tufA)