Structure of PDB 2c77 Chain A

Receptor sequence

>2c77A (length=404) Species: 300852 (Thermus thermophilus HB8)

KGEFIRTKPHVNVGTIGHVDHGKTTLTAALTYVTAAENPNVEVKDYGDID
KAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDG
AILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVE
MEVRDLLNQYEFPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWE
LLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
EVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERG
QVLAKPGSITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTG
VVQLPPGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVVT
KILE

3D structure

• PDB: 2c77 Structural basis of the action of pulvomycin and GE2270 A on elongation factor Tu.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T62 H85
• Catalytic site (residue number reindexed from 1): D20 K23 T24 T61 H84
• Enzyme Commision number: 3.1.5.1: dGTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	H67 V68 S78 Q98 E226 D227 R234 T239 G269 E271 H273 R274 N285 V286 G287 L289	H66 V67 S77 Q97 E225 D226 R233 T238 G268 E270 H272 R273 N284 V285 G286 L288
BS02	GNP	A	V20 D21 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176	V19 D20 G22 K23 T24 T25 Y46 I60 T61 G83 N135 K136 D138 M139 S173 L175
BS03	MG	A	T25 T62	T24 T61

Gene Ontology

Molecular Function

• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2c77, PDBe:2c77, PDBj:2c77
• PDBsum: 2c77
• PubMed: 16734421
• UniProt: P60339|EFTU2_THET8 Elongation factor Tu-B (Gene Name=tufB)