Structure of PDB 2c6y Chain A

Receptor sequence
>2c6yA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNS
IRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
3D structure
PDB2c6y Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K3 S7 Y8 N49 H53 K73 R95 R98 K3 S7 Y8 N49 H53 K73 R95 R98
BS02 dna A L26 R52 H53 S56 L57 K63 K73 G74 W77 R98 L26 R52 H53 S56 L57 K63 K73 G74 W77 R98
BS03 MG A L55 F61 L55 F61
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c6y, PDBe:2c6y, PDBj:2c6y
PDBsum2c6y
PubMed16624804
UniProtQ01167|FOXK2_HUMAN Forkhead box protein K2 (Gene Name=FOXK2)

[Back to BioLiP]