Structure of PDB 2c62 Chain A

Receptor sequence
>2c62A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence]
AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
QLKEQISDIDDAVRKL
3D structure
PDB2c62 A Global Transcription Cofactor Bound to Juxtaposed Strands of Unwound DNA
ChainA
Resolution1.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R70 R75 F77 K80 L82 D84 R86 W89 P98 G99 R100 K101 S104 N106 R9 R14 F16 K19 L21 D23 R25 W28 P37 G38 R39 K40 S43 N45
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c62, PDBe:2c62, PDBj:2c62
PDBsum2c62
PubMed16415882
UniProtP53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 (Gene Name=SUB1)

[Back to BioLiP]