Structure of PDB 2c60 Chain A |
>2c60A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] |
GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMN NELSILLKNQDDLDKAIDILDRSSSMKSLRILLLS |
|
PDB | 2c60 Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution |
Chain | A |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.25: mitogen-activated protein kinase kinase kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
L107 S110 M113 |
L70 S73 M76 |
|
|
|