Structure of PDB 2c3h Chain A

Receptor sequence
>2c3hA (length=93) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence]
SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTI
EGVESVRLLFKDRGTNQWPGPGEPGFFRDQDGWFDGEWHVDRP
3D structure
PDB2c3h A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
ChainA
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A Y22 W35 Q70 P74 G75 Y19 W32 Q67 P71 G72
BS02 GLC A Y22 Y24 G75 E76 P77 Y19 Y21 G72 E73 P74
BS03 GLC A P74 G75 P71 G72
External links