Structure of PDB 2c2r Chain A

Receptor sequence

>2c2rA (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2c2r Efficient and High Fidelity Incorporation of Dctp Opposite 7,8-Dihydro-8-Oxodeoxyguanosine by Sulfolobus Solfataricus DNA Polymerase Dpo4
• Chain: A
• Resolution: 2.55 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E106 K152 G185 G187 I189 T190 K193 I295 R298 R300 T301 K339 F340 I341	E106 K152 G185 G187 I189 T190 K193 I295 R298 R300 T301 K339 F340 I341
BS02	dna	A	V32 S34 G41 A42 P60 V62 G218 K221 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332 R336	V32 S34 G41 A42 P60 V62 G218 K221 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332 R336
BS03	DCT	A	D9 Y10 R51 A57	D9 Y10 R51 A57
BS04	CA	A	D7 D105 E106	D7 D105 E106
BS05	CA	A	D7 F8 D105	D7 F8 D105
BS06	CA	A	A181 I186 G187	A181 I186 G187

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2c2r, PDBe:2c2r, PDBj:2c2r
• PDBsum: 2c2r
• PubMed: 16306039
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)