Structure of PDB 2c2f Chain A |
>2c2fA (length=178) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] |
GGADHADAAHLGTVNNALVNHHYLEEKEFQTVAETLQRNLATTISLYLKF KKYHWDIRGRFFRDLHLAYDEFIAEIFPSIDEQAERLVALGGSPLAAPAD LARYSTVQVPQETVRDARTQVADLVQDLSRVGKGYRDDSQACDEANDPVT ADMYNGYAATIDKIRWMLQAIMDDERLD |
|
PDB | 2c2f The Crystal Structure of Deinococcus Radiodurans Dps Protein (Dr2263) Reveals the Presence of a Novel Metal Centre in the N Terminus. |
Chain | A |
Resolution | 1.61 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D36 H39 H50 E55 |
D7 H10 H21 E26 |
|
|
|
|