Structure of PDB 2bz7 Chain A |
>2bz7A (length=102) Species: 97234 (Dryopteris crassirhizoma) [Search protein sequence] |
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETPHNIVFDIPAGAPGT VASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLT VK |
|
PDB | 2bz7 Protonation of a Histidine Copper Ligand in Fern Plastocyanin. |
Chain | A |
Resolution | 1.76 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H37 C87 H90 |
H37 C87 H90 |
|
|
|
|