Structure of PDB 2bwk Chain A

Receptor sequence
>2bwkA (length=117) Species: 10090 (Mus musculus) [Search protein sequence]
DSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSN
IKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHV
VIACENGLPVHFDESFF
3D structure
PDB2bwk Structure of Murine Angiogenin: Features of the Substrate- and Cell-Binding Regions and Prospects for Inhibitor-Binding Studies.
ChainA
Resolution1.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H13 K40 H113 F114 D115
Catalytic site (residue number reindexed from 1) H11 K38 H111 F112 D113
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A H13 H113 S117 F119 H11 H111 S115 F117
BS02 SO4 A Y6 K50 K54 Y4 K48 K52
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003779 actin binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0004549 tRNA-specific ribonuclease activity
GO:0005102 signaling receptor binding
GO:0005507 copper ion binding
GO:0008201 heparin binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007417 central nervous system development
GO:0009303 rRNA transcription
GO:0017148 negative regulation of translation
GO:0023052 signaling
GO:0030041 actin filament polymerization
GO:0030154 cell differentiation
GO:0032055 negative regulation of translation in response to stress
GO:0034063 stress granule assembly
GO:0036417 tRNA destabilization
GO:0043066 negative regulation of apoptotic process
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050714 positive regulation of protein secretion
GO:0071425 hematopoietic stem cell proliferation
GO:0071470 cellular response to osmotic stress
GO:2000773 negative regulation of cellular senescence
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030139 endocytic vesicle
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0032311 angiogenin-PRI complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bwk, PDBe:2bwk, PDBj:2bwk
PDBsum2bwk
PubMed16301790
UniProtP21570|ANGI_MOUSE Angiogenin (Gene Name=Ang)

[Back to BioLiP]