Structure of PDB 2bvj Chain A

Receptor sequence

>2bvjA (length=394) Species: 54571 (Streptomyces venezuelae)

VLDLGALGQDFAADPYPTYARLRAEGPAHRVRTPEGDEVWLVVGYDRARA
VLADPRFSKDWRNSTTPLTEAEAALNHNMLESDPPRHTRLRKLVAREFTM
RRVELLRPRVQEIVDGLVDAMLAAPDGRADLMESLAWPLPITVISELLGV
PEPDRAAFRVWTDAFVFPDDPAQAQTAMAEMSGYLSRLIDSKRGQDGEDL
LSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHP
DQLAALRADMTLLDGAVEEMLRYEGPVESATYRFPVEPVDLDGTVIPAGD
TVLVVLADAHRTPERFPDPHRFDIRRDTAGHLAFGHGIHFCIGAPLARLE
ARIAVRALLERCPDLALDVSPGELVWYPNPMIRGLKALPIRWRR

3D structure

• PDB: 2bvj The Structural Basis for Substrate Anchoring, Active Site Selectivity, and Product Formation by P450 Pikc from Streptomyces Venezuelae.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D23 P47 F180 A243 E246 T247 T248 V290 C354 I355 G356 E363 I395
• Catalytic site (residue number reindexed from 1): D10 P34 F167 A230 E233 T234 T235 V277 C341 I342 G343 E350 I382
• Enzyme Commision number: 1.14.15.33: pikromycin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M92 L93 H100 R104 F111 A243 G244 T247 T248 L251 T294 R296 A346 F347 G348 H352 C354 I355 G356 A360	M79 L80 H87 R91 F98 A230 G231 T234 T235 L238 T281 R283 A333 F334 G335 H339 C341 I342 G343 A347

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0017000 antibiotic biosynthetic process
• GO:0033068 macrolide biosynthetic process

External links

• PDB: RCSB:2bvj, PDBe:2bvj, PDBj:2bvj
• PDBsum: 2bvj
• PubMed: 16825192
• UniProt: O87605|PIKC_STRVZ Cytochrome P450 monooxygenase PikC (Gene Name=pikC)