Structure of PDB 2buj Chain A

Receptor sequence
>2bujA (length=291) Species: 9606 (Homo sapiens) [Search protein sequence]
NLYFQGHMVIIDNKHYLFIQKLGEFSYVDLVEGLHDGHFYALKRILCHEQ
QDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTL
WNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILL
GDEGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSV
QSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQIPQS
PRHSSALWQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPG
3D structure
PDB2buj Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D148 K150 N153 D166 T195
Catalytic site (residue number reindexed from 1) D142 K144 N147 D160 T189
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 STU A L26 E28 V34 A47 F100 F101 M165 L22 E24 V28 A41 F94 F95 M159
BS02 STU A E87 H92 E81 H86
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0004715 non-membrane spanning protein tyrosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0016310 phosphorylation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046777 protein autophosphorylation
GO:0071560 cellular response to transforming growth factor beta stimulus
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005798 Golgi-associated vesicle
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2buj, PDBe:2buj, PDBj:2buj
PDBsum2buj
PubMed
UniProtO75716|STK16_HUMAN Serine/threonine-protein kinase 16 (Gene Name=STK16)

[Back to BioLiP]