Structure of PDB 2brq Chain A

Receptor sequence
>2brqA (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS
3D structure
PDB2brq The Molecular Basis of Filamin Binding to Integrins and Competition with Talin.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G2267 A2268 G2269 G2270 L2271 A2272 I2273 A2274 V2275 E2276 G2277 P2278 S2279 K2280 A2281 I2283 F2285 G32 A33 G34 G35 L36 A37 I38 A39 V40 E41 G42 P43 S44 K45 A46 I48 F50
BS02 GSH A T2263 F2285 G2291 S2292 C2293 G2294 T28 F50 G56 S57 C58 G59
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2brq, PDBe:2brq, PDBj:2brq
PDBsum2brq
PubMed16455489
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]