Structure of PDB 2bpe Chain A |
>2bpeA (length=128) Species: 10090 (Mus musculus) [Search protein sequence] |
QSCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFI ESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNAVPQESLL HNCVWIHGSEVYNQICNTSSYSICEKEL |
|
PDB | 2bpe Structure of the Fungal Beta-Glucan-Binding Immune Receptor Dectin-1: Implications for Function. |
Chain | A |
Resolution | 2.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
K156 D158 E162 E241 |
K40 D42 E46 E125 |
|
|
|
|